PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G236300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 171aa    MW: 18373.6 Da    PI: 8.6531
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G236300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.68.9e-1695150560
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                         ++ +r++kNRe+A rsR+RK+a+++eLe++v  L +eN +Lk + ++lk e+a+l 
  Sevir.3G236300.1.p  95 RKNIRMMKNRESALRSRARKRAYVQELEKEVRRLVNENLKLKRQCKQLKVEMAALI 150
                         6889********************************************99998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.2E-1590151No hitNo description
SMARTSM003386.2E-1491155IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.64593149IPR004827Basic-leucine zipper domain
CDDcd147072.08E-1695149No hitNo description
PfamPF001701.4E-1295149IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-1295150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MPRSPQLSLS GCSSLFSLSS TSTSRDNDSA AAAAPPPSSL HPLPPRGPLL SLSVGGGGDE  60
EQEEEEEYLL GGLDLQLTGA GGSNSSGCCD GDDERKNIRM MKNRESALRS RARKRAYVQE  120
LEKEVRRLVN ENLKLKRQCK QLKVEMAALI QTSSSKGNSH IRRTSSSTQL *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961973.11e-119PREDICTED: protein FD-like
TrEMBLK3ZA771e-119K3ZA77_SETIT; Uncharacterized protein
STRINGSi023448m1e-119(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40173072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.14e-14bZIP family protein